DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and ABHD14A

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_056222.2 Gene:ABHD14A / 25864 HGNCID:24538 Length:271 Species:Homo sapiens


Alignment Length:332 Identity:63/332 - (18%)
Similarity:110/332 - (33%) Gaps:116/332 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GHISGKWYGPKHVRPIVGMHGWQDNAGTFDTLAP------------------LLPSHLSFLSIDA 90
            |.:.|.|:.....||::             .|.|                  ||...|.::.:..
Human     3 GALCGCWFRLGGARPLI-------------PLGPTVVQTSMSRSQVALLGLSLLLMLLLYVGLPG 54

  Fly    91 PGHGLSS-W----------LPPGTS------------YHSIDLVLITRRLMEEYNWDKISILAHS 132
            |....|. |          |.||.|            .|.:::||:..:....:.|:::..|  .
Human    55 PPEQTSCLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTL--Q 117

  Fly   133 MSSINGFVFSALFPDKVDLFVGLDVLKPPVRSARGIVDSLTERIESALKLERRLKSGSEPPAYDW 197
            :.|..|:           ..|.||:  |...::....::.||...:|| |||.|:......|.  
Human   118 LLSQRGY-----------RAVALDL--PGFGNSAPSKEASTEAGRAAL-LERALRDLEVQNAV-- 166

  Fly   198 DQLVTRLHEGSNKSVSIDACKYLLQRNCKPSTHEPHKYYFSRDNRLKSSLFYTLHQEVPMEMARR 262
              ||:....|..      |..:|::.:     |:.|.:.         .:..|..|....|....
Human   167 --LVSPSLSGHY------ALPFLMRGH-----HQLHGFV---------PIAPTSTQNYTQEQFWA 209

  Fly   263 IKCPHLFIKALQAPYYERKEYFDEVLA-----ELQKNPLFEYHEV----EGTHHVHLNEPEKVAP 318
            :|.|.|.:      |.|    .|.:||     :|:..|   .|.|    ...|..:|::|:....
Human   210 VKTPTLIL------YGE----LDHILARESLRQLRHLP---NHSVVKLRNAGHACYLHKPQDFHL 261

  Fly   319 IINSFIN 325
            ::.:|::
Human   262 VLLAFLD 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 60/319 (19%)
ABHD14ANP_056222.2 MhpC 74..270 CDD:223669 50/248 (20%)
Abhydrolase_5 97..250 CDD:289465 41/205 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.