DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and EPHX4

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_775838.3 Gene:EPHX4 / 253152 HGNCID:23758 Length:362 Species:Homo sapiens


Alignment Length:319 Identity:53/319 - (16%)
Similarity:115/319 - (36%) Gaps:76/319 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KPFKILNKHFDEISIPVPWGHISGKWYGPKHVRPIVGMHGWQDNAGTFDTLAPLLPSHLSFLSID 89
            ||..:|...|.|.            ||            .|:.....|       .|....:::|
Human    93 KPLMLLLHGFPEF------------WY------------SWRYQLREF-------KSEYRVVALD 126

  Fly    90 APGHGLSSWLPPGTSYHSID-LVLITRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFV 153
            ..|:|.:. .|.....:.:| |:...:.:::...:.|..::.|....:..::.:..:|:.|...:
Human   127 LRGYGETD-APIHRQNYKLDCLITDIKDILDSLGYSKCVLIGHDWGGMIAWLIAICYPEMVMKLI 190

  Fly   154 GLDVLKPPVRSARGIVDSLTERIESALKLERRLKSGS-----EPP-----AYDWDQLVTRLHEGS 208
            .::...|.|         .||.|   |:...:|...|     :.|     .:..:......|..:
Human   191 VINFPHPNV---------FTEYI---LRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFT 243

  Fly   209 NKSVSIDACKYLLQRNCKPSTH--EPHKYYFSRDNRLKSSL--FYTLHQEVPMEMARRIKCPHLF 269
            :.|..|.      ::.|:.:|.  |.:.|.||:...|...:  :..:...:|:: ...:..|.|.
Human   244 SHSTGIG------RKGCQLTTEDLEAYIYVFSQPGALSGPINHYRNIFSCLPLK-HHMVTTPTLL 301

  Fly   270 IKALQAPYYERKEYFDEVLAELQKNPLFEYHEV----EGTHHVHLNEPEKVAPIINSFI 324
            :      :.|...:.:..:||:.|..:..|..:    |.:|.:..::|:.|..:|.:|:
Human   302 L------WGENDAFMEVEMAEVTKIYVKNYFRLTILSEASHWLQQDQPDIVNKLIWTFL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 46/287 (16%)
EPHX4NP_775838.3 MhpC 76..350 CDD:223669 51/313 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.