DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and Ephx1

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001029262.1 Gene:Ephx1 / 25315 RGDID:2557 Length:455 Species:Rattus norvegicus


Alignment Length:406 Identity:79/406 - (19%)
Similarity:123/406 - (30%) Gaps:153/406 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLKQLPNVRNSSSGPTKPFKILNKHFDEISIP-VPWGHISGKWYGPKHVRPIVGMHGWQDNAGTF 72
            :|.|.|:.:....|       |:.||..:..| :|.|..      ||   |::.:|||..:...|
  Rat   109 ILNQYPHFKTKIEG-------LDIHFIHVKPPQLPSGRT------PK---PLLMVHGWPGSFYEF 157

  Fly    73 DTLAPLLPSHLSFLSIDAPGHGLSS------WLP--PGTSY---------HSIDLVLITRRLMEE 120
            ..:.|||        .|...||||.      ..|  ||..|         :|:....|..:||..
  Rat   158 YKIIPLL--------TDPKSHGLSDEHVFEVICPSIPGYGYSEASSKKGLNSVATARIFYKLMTR 214

  Fly   121 YNWDK---------------------------------ISILAHSMSSINGFVF----------- 141
            ..:.|                                 ||...::|:.:.|..|           
  Rat   215 LGFQKFYIQGGDWGSLICTNMAQMVPNHVKGLHLNMAFISRSFYTMTPLLGQRFGRFLGYTEKDI 279

  Fly   142 SALFPDKVDLF-------------------VGLDVLKPPVRSARGIVDSLTERIESALKLE-RRL 186
            ..|:|.|..:|                   ||..:...||    |:...:.|:..:..|.| |.|
  Rat   280 ELLYPYKEKVFYSIMRESGYLHIQATKPDTVGCALNDSPV----GLAAYILEKFSTWTKSEYREL 340

  Fly   187 KSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYL---LQRNCKPSTHEPHKYY----FSRDNRLK 244
            :.|.....:..|.|:..:.........:.:.:|.   |.:......||..|.:    ||   ...
  Rat   341 EDGGLERKFSLDDLLVNIMIYWTTGTIVSSQRYYKENLGQGIMVHKHEGMKVFVPTGFS---AFP 402

  Fly   245 SSLFYTLHQEVPMEMARRIKCPHLFIKALQAPYYERKEYFDEVLAELQKNPLFEYHEVEGTHHVH 309
            |.|.:...:.|      ::|.|    |.:...|.||                       |.|...
  Rat   403 SELLHAPEKWV------KVKYP----KLISYSYMER-----------------------GGHFAA 434

  Fly   310 LNEPEKVAPIINSFIN 325
            ..||:.:|..|..|::
  Rat   435 FEEPKLLAQDIRKFVS 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 67/357 (19%)
Ephx1NP_001029262.1 EHN 48..157 CDD:399447 16/63 (25%)
Abhydrolase_1 142..401 CDD:395444 52/276 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.