DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and K08D9.4

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001305193.1 Gene:K08D9.4 / 187147 WormBaseID:WBGene00019525 Length:311 Species:Caenorhabditis elegans


Alignment Length:353 Identity:75/353 - (21%)
Similarity:124/353 - (35%) Gaps:101/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVSRGLFLLKQLPNVRNSSSGPTKPFKILNK-----------------HFDEISIPVPWGHISG 48
            |.:|:|.|          |:...|:| |:.:|                 :.|.:|...|.|    
 Worm     1 MIMSKGAF----------STLPATEP-KLYSKLVQFQTKRRRLVDLNAVYEDSLSSGSPLG---- 50

  Fly    49 KWYGPKHVRPIVGMHGWQDNAGTFDTLAPLLPSHLS--FLSIDAPGHGLSSWLP--PGTSYHSID 109
                     .::|.||...:...|..:...| .|::  |:.|:.||.   ...|  ||..:.:.:
 Worm    51 ---------TVIGFHGTPGSHRDFKYVRQRL-EHMNIRFIGINYPGF---KQTPAYPGQHFGNWE 102

  Fly   110 LVLITRRLMEEYNW-DKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPP-VRSARGIVDSL 172
            ....:..|:.|.:. .|:.|:.||....|..:.:|.....     ||.:..|. :|..:|  ...
 Worm   103 RNSYSEALLNELDVPGKVIIMGHSRGCENALITAANRKPH-----GLVMANPTGLRINKG--SRP 160

  Fly   173 TERIESALKLERRL-KSGSEPPAYDWDQLV-TRLHEGSNKSVSIDACKYLLQRNCKPSTHEPHKY 235
            ..::||.:.|.::| |...:...|:..:|| .::|:|......|.|.     .||.         
 Worm   161 KGKLESLIYLHKKLPKKIGDAILYNLMKLVGFKIHDGEEAVAVIRAI-----MNCD--------- 211

  Fly   236 YFSRDNRLKSSLFYTLH-QEVPME-MARRIKCPHLFIKALQAPYYERKEYFDEVLAELQKNPLFE 298
                   |:..|.|.|. .|:|.: |.......||.          .||...|.|.:.|....|.
 Worm   212 -------LEKQLEYILKLNELPTKTMITFGGSDHLI----------EKEIVFEALKKYQGLAHFN 259

  Fly   299 YHEVEGTHHVHLNEPEKVAPIINSFINR 326
            :       ..::.|.|| ..|:.||.|:
 Worm   260 F-------KANITESEK-QKIMESFKNQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 61/278 (22%)
K08D9.4NP_001305193.1 DUF1057 15..310 CDD:115027 69/329 (21%)
MhpC 46..258 CDD:223669 56/266 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156746
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.