DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and abhd-11.1

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_492942.1 Gene:abhd-11.1 / 185192 WormBaseID:WBGene00009316 Length:297 Species:Caenorhabditis elegans


Alignment Length:227 Identity:42/227 - (18%)
Similarity:88/227 - (38%) Gaps:47/227 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 IDLVLITRRLMEEYNWDKISILAHSM--SSINGFVFSALFPDKVDLFVGLDV--LKPPVRSARGI 168
            ||.|   |::..|   ||:::..|||  .::.....:..:..::...:..|:  |..|::.|. .
 Worm    96 IDWV---RKITGE---DKVNLHGHSMGGKAVTQLATTPEYSSRIKSLIVEDMSPLGYPLKRAE-Y 153

  Fly   169 VDSLTERIESALKLERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPSTHEPH 233
            ::.:.:.|.:.:.     ||.||        ::..|.|..:|.:.....:..|..:.....|   
 Worm   154 LECIKQMIATDMN-----KSRSE--------VMAELGEKVSKVLLYQFVRGNLGEDVNGKAH--- 202

  Fly   234 KYYFSRDNRLKSSLFYTLHQEVPMEMARRIKCPHLFIKA-----LQAPYYERKEYFDEVLAELQK 293
              :....|.:..:..|.|..::...:   ...|.||.:|     |.|.:..|.|         :.
 Worm   203 --WICNLNVIDETYIYLLSHDIRFGV---FDGPTLFQRAPGSGFLPAAHKNRVE---------KM 253

  Fly   294 NPLFEYHEVEGTHH-VHLNEPEKVAPIINSFI 324
            .|:.::.|...::| :|.::|:.....|..|:
 Worm   254 FPMVQFAETAWSNHWIHADDPKFFVDSICEFL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 42/227 (19%)
abhd-11.1NP_492942.1 PRK10673 36..287 CDD:182637 42/227 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.