DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and abhd-5.1

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_504299.2 Gene:abhd-5.1 / 183295 WormBaseID:WBGene00016506 Length:355 Species:Caenorhabditis elegans


Alignment Length:292 Identity:61/292 - (20%)
Similarity:111/292 - (38%) Gaps:65/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PIVGMHGWQDNAGTFDTLAPLLPSHLSFLSIDAPGHGLSSWLPPGTSYHSIDLVLITRRLMEEY- 121
            |||.:||:......:.:....|....:..:||.||.|.||.....|...:.:..:|  ..:|:: 
 Worm    73 PIVLIHGFGAGVALWGSAIKRLAQFQNVYAIDLPGFGRSSRTKFSTDPETAEKEMI--EAIEQWR 135

  Fly   122 ---NWDKISILAHSMSSINGFVFSALFPDKVDLFV-----GLDVLKPPVRSARGIVDSLTERIES 178
               |.:|::::.||........::..:|.:::..:     |...:.|      ..::.||:|.::
 Worm   136 VKMNLEKMNLVGHSFGGYLSTSYALKYPKRIENLILADPWGFTDVDP------SFLEKLTKRQKA 194

  Fly   179 ----ALKLE----RRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKPSTHEPHKY 235
                .||..    .||..|..|      .|:.||.....:..|.|...|:...|....|.|  ..
 Worm   195 LFWVILKFNPLAALRLVGGYGP------SLMKRLRPDLEQKYSEDVYDYIYLANSGNPTGE--II 251

  Fly   236 YFSRDNRLK------SSLFYTLHQEVPMEMARRIKCPHLFIKALQA--PYYERKEYF---DEVLA 289
            :.|....|:      |..|:.|.:.||::          ||....:  .:...:|.|   |.|  
 Worm   252 FKSLSENLRWAKNPMSKRFHELDKTVPVK----------FIHGGMSWVDWKTTREMFGSMDHV-- 304

  Fly   290 ELQKNPLFEYHEVEGT-HHVHLNEPEKVAPII 320
                    |.|.:||. |||:.::.::...::
 Worm   305 --------ESHIIEGAGHHVYADDTDRFVELV 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 61/292 (21%)
abhd-5.1NP_504299.2 Abhydrolase_1 72..321 CDD:278959 61/283 (22%)
Abhydrolase_5 73..>179 CDD:289465 22/107 (21%)
PKc_like <219..>274 CDD:304357 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156711
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.