DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and B0464.9

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_499084.1 Gene:B0464.9 / 181999 WormBaseID:WBGene00007188 Length:364 Species:Caenorhabditis elegans


Alignment Length:233 Identity:50/233 - (21%)
Similarity:88/233 - (37%) Gaps:61/233 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LKQLPNVRNSSSGPTKPFKILNKHFDEIS----IPVPWGHISGK--------W---YGPKHVRPI 59
            |..||::::.:|..|.|.:..:.....::    .|||....|||        |   :..|....|
 Worm     6 LDTLPDLQSETSHVTTPHRQNDLLRQAVTHGRPPPVPSTSTSGKKREMSELPWSDFFDEKKDANI 70

  Fly    60 VG-----------------MHGWQDNAGTFDTLAPLLPSHLS--FLSIDAPGHGLSSWLPPGTSY 105
            .|                 :||...:..|:...|..|.:.:|  .::.|..|||.:..    :..
 Worm    71 DGDVFNVYIKGNEGPIFYLLHGGGYSGLTWACFAKELATLISCRVVAPDLRGHGDTKC----SDE 131

  Fly   106 HSI-------DLVLITRRLMEEYNWDKISILAHSMS------SINGFVFSALFPDKVDLFVGLDV 157
            |.:       |:..|.:.:..|.: ..:.|:.|||.      ::|..:.|:    ||...:.:||
 Worm   132 HDLSKETQIKDIGAIFKNIFGEDD-SPVCIVGHSMGGALAIHTLNAKMISS----KVAALIVIDV 191

  Fly   158 LKPPVRSA-RGIVDSLTERIESALKLERR----LKSGS 190
            ::.....| .|:|..|..|..|...:|:.    |.||:
 Worm   192 VEGSAMEALGGMVHFLHSRPSSFPSIEKAIHWCLSSGT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 36/171 (21%)
B0464.9NP_499084.1 Fe-S_biosyn 49..>89 CDD:294282 5/39 (13%)
MhpC 68..337 CDD:223669 36/171 (21%)
Abhydrolase_5 89..>190 CDD:289465 22/109 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.