DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and F10D2.10

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_504815.2 Gene:F10D2.10 / 179101 WormBaseID:WBGene00017335 Length:333 Species:Caenorhabditis elegans


Alignment Length:335 Identity:56/335 - (16%)
Similarity:107/335 - (31%) Gaps:107/335 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NSSSGPTKPFKILNKHFDEISIPVPWGHISGKWYGPKHVRPIVGMHGWQDNAGTFDTLAPLLPSH 82
            :.|.|....||.:.:.|||..|                                           
 Worm    70 HGSPGSHNDFKYIRQQFDEAGI------------------------------------------- 91

  Fly    83 LSFLSIDAPGHGLSSWLPPGTSYHSIDLVLITRRLMEEYNWD-KISILAHSMSSINGFVFSALFP 146
             .|:.::.||...:... ||..:.:.:....|...::..:.. |:..||||....|..:.:..||
 Worm    92 -RFIGLNYPGFKQTDGY-PGQGHCNKERQNYTDAFLKSADLSGKVIFLAHSRGCENALMTATTFP 154

  Fly   147 DKVDLFVGLDVLKP----PVRSARGIVDSLTERIESALKLERRLKSGSEPPAYDWDQLVTRLHEG 207
            ..     ||.::.|    ..:|.|.:  |..||||....:         .|.:..|.::.|::..
 Worm   155 AH-----GLVMMNPLGLRKHKSIRPL--SRLERIEWVYDM---------LPKFLADAMIYRMYLS 203

  Fly   208 SNKSV-----SIDACKYLLQRNCKPSTHEPHKYYFSRDNRLKSSLFYTLHQEVPMEMARRIKC-P 266
            ....|     :|.|.:.:::...:.:....||.   |:...|:.:.:.         .:.:.| .
 Worm   204 FGLKVQDGEEAISALRSVIRCGLETTLPNIHKL---REQDTKTFIIFA---------GKDLICED 256

  Fly   267 HLFIKALQAPYYERKEYFDEVLAELQKN-PLFEYHEV---------------EGTHHVHLNEPEK 315
            .:..:||       |||.|.|..:.... |..:|.::               :.||..:....:.
 Worm   257 EIVFEAL-------KEYRDLVHFDYDSEIPTDDYGKILKTFDSEKGASVFVAKDTHFQNKKRADL 314

  Fly   316 VAPIINSFIN 325
            ||.::....:
 Worm   315 VAEVVKKIFD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 48/296 (16%)
F10D2.10NP_504815.2 DUF1057 29..324 CDD:115027 56/333 (17%)
MhpC 59..272 CDD:223669 50/281 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156747
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.