DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and Mest

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001239221.1 Gene:Mest / 17294 MGIID:96968 Length:342 Species:Mus musculus


Alignment Length:254 Identity:49/254 - (19%)
Similarity:77/254 - (30%) Gaps:105/254 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ISIPVP--------WGHISGKWYGPKHVRPIVGMHGWQDNAGTFDTLAPLLPSH----------- 82
            :.||.|        | ..|||::..|.:|..     :||:.|...:...::..|           
Mouse    36 LHIPPPQLSPALHSW-KTSGKFFTYKGLRIF-----YQDSVGVVGSPEIVVLLHGFPTSSYDWYK 94

  Fly    83 ------LSF---LSIDAPGHGLSSWLPPGTSYHSIDLVLITRRLMEEYNWD--KISILAHSMSSI 136
                  |.|   :::|..|.|.|. .|....|...:...|...|:......  :|::|:|....|
Mouse    95 IWEGLTLRFHRVIALDFLGFGFSD-KPRPHQYSIFEQASIVESLLRHLGLQNRRINLLSHDYGDI 158

  Fly   137 -------------------------NGFVF-------------------SALFPDKVDLFV---G 154
                                     ||.:|                   |.:....::.||   |
Mouse   159 VAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRG 223

  Fly   155 LDVLKPP---------------VRSARG--IVDSLTERIESALKLERR----LKSGSEP 192
            |..:..|               :|:..|  ::|||.:.|....|..||    |.|.|.|
Mouse   224 LTPVFGPYTRPTESELWDMWAVIRNNDGNLVIDSLLQYINQRKKFRRRWVGALASVSIP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 41/226 (18%)
MestNP_001239221.1 MhpC 54..328 CDD:223669 44/235 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.