DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7632 and bphl

DIOPT Version :9

Sequence 1:NP_649302.1 Gene:CG7632 / 40357 FlyBaseID:FBgn0037071 Length:330 Species:Drosophila melanogaster
Sequence 2:XP_002936463.1 Gene:bphl / 100489969 XenbaseID:XB-GENE-988291 Length:287 Species:Xenopus tropicalis


Alignment Length:301 Identity:62/301 - (20%)
Similarity:100/301 - (33%) Gaps:95/301 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VGMH----GWQDNA--------GTFDT-LAPLLPS----HLSFLSIDAPGHGLSSWLPPGTSY-- 105
            :.:|    ||.|:|        |:..| ..|.|.|    ..:.::.|..|:|.|  :||...|  
 Frog    43 INLHYQRTGWGDHAVLLLPGVLGSGQTDFGPQLKSLDKEAFTIIAWDPRGYGYS--IPPSRDYPL 105

  Fly   106 --------HSIDLVLITRRLMEEYNWDKISILAHSMSSINGFVFSALFPDKVDLFVGLDVLKPPV 162
                    .::|       ||:..|:.|.|:|..|...|...:.:..:|..:...|        |
 Frog   106 DFFERDAKDAVD-------LMQALNFKKFSLLGWSDGGITALIGAGTYPSLIKKLV--------V 155

  Fly   163 RSARGIVDSLTERIESALKLERRLKSGSEPPAYDWDQLVTRLHEGSNKSVSIDACKYLLQRNCKP 227
            ..|...|      .|..|||...:|..|     :|.:.:.                       ||
 Frog   156 WGANAFV------TEEDLKLYNAVKDVS-----NWSKKMR-----------------------KP 186

  Fly   228 STHEPHKYYFSRDNRLKSSLFYTLHQ----EVPMEMARRIKCPHLFIKALQ---APYYERKEYFD 285
            ......|.||:...:......|.|..    .:...:...|.||.|.|..|:   .|.: ..:|..
 Frog   187 MEDLYGKEYFANTFKAWCEAMYKLASRPDGNICQHLLPLIDCPTLIIHGLKDAMVPSF-HPQYIH 250

  Fly   286 EVL--AELQKNPLFEYHEVEGTHHVHLNEPEKVAPIINSFI 324
            |.:  :.|...|       :|.|::||...|:...::..|:
 Frog   251 EQIKGSRLHLMP-------DGKHNLHLRYAEEFNRLVKDFL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7632NP_649302.1 MhpC 57..326 CDD:223669 62/301 (21%)
bphlXP_002936463.1 MhpC 35..284 CDD:223669 61/299 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.