DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11309 and Abhd14a

DIOPT Version :10

Sequence 1:NP_649301.1 Gene:CG11309 / 40356 FlyBaseID:FBgn0037070 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_006511859.1 Gene:Abhd14a / 68644 MGIID:1915894 Length:273 Species:Mus musculus


Alignment Length:72 Identity:21/72 - (29%)
Similarity:28/72 - (38%) Gaps:30/72 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 WYGPQNVQPILG--------------------------LHGWQDNAGTFDRL--MPLLSP-DVAF 96
            |.|| ||..:.|                          |||...|:.|:::|  :.|||. ....
Mouse    40 WRGP-NVTVLTGLTRGNSRIFYREVLPIQQARRAEVVFLHGKAFNSHTWEQLGTLQLLSERGYRA 103

  Fly    97 LAIDLPG 103
            :||||||
Mouse   104 VAIDLPG 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11309NP_649301.1 alpha/beta hydrolases 69..324 CDD:473884 16/64 (25%)
Abhd14aXP_006511859.1 MenH 51..272 CDD:440361 15/60 (25%)

Return to query results.
Submit another query.