DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11309 and Ephx2

DIOPT Version :10

Sequence 1:NP_649301.1 Gene:CG11309 / 40356 FlyBaseID:FBgn0037070 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_075225.1 Gene:Ephx2 / 65030 RGDID:620732 Length:554 Species:Rattus norvegicus


Alignment Length:190 Identity:45/190 - (23%)
Similarity:75/190 - (39%) Gaps:42/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TITGSDLGQRYRHAGDLTG----EAPTRPRANIWCSKKYFAEISITVPWG---HISGKWYGPQNV 67
            ||...|.....|....:||    |||    ..:.||....:...:||..|   |......||   
  Rat   200 TILVRDTASALRELEKVTGTQFPEAP----LPVPCSPNDVSHGYVTVKPGIRLHFVEMGSGP--- 257

  Fly    68 QPILGLHGWQDNAGTFDRLMPLLSPDVAF--LAIDLPGHGLSSRLPDGCYYNSVDNLYVIRLIMK 130
             .|...||:.::..::...:|.|: ...|  ||||:.|:|.||..|:      ::. |.:.|:.:
  Rat   258 -AICLCHGFPESWFSWRYQIPALA-QAGFRVLAIDMKGYGDSSSPPE------IEE-YAMELLCE 313

  Fly   131 QYKWEKVS-----------LVGHSMSSIICFVFAAVFPDKVDMIIGIDALKPHQRPYPSV 179
                |.|:           .:||..:.::.:..|...|::|..:..::.  |...|.|.|
  Rat   314 ----EMVTFLNKLGIPQAVFIGHDWAGVLVWNMALFHPERVRAVASLNT--PLMPPNPEV 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11309NP_649301.1 alpha/beta hydrolases 69..324 CDD:473884 28/124 (23%)
Ephx2NP_075225.1 Phosphatase 1..224 6/23 (26%)
HAD_sEH-N_like 3..214 CDD:319790 4/13 (31%)
Epoxide hydrolase 233..554 34/153 (22%)
Abhydrolase_1 257..530 CDD:395444 29/129 (22%)
Microbody targeting signal. /evidence=ECO:0000255 552..554
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.