DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11309 and ABHD6

DIOPT Version :10

Sequence 1:NP_649301.1 Gene:CG11309 / 40356 FlyBaseID:FBgn0037070 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_005265391.1 Gene:ABHD6 / 57406 HGNCID:21398 Length:338 Species:Homo sapiens


Alignment Length:108 Identity:28/108 - (25%)
Similarity:50/108 - (46%) Gaps:15/108 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PQNVQPILGLHGWQDNAGTFDRLMPLLSPDVAFLAIDLPGHGLSSRLPDGCYYNSVDNLYV---- 124
            |.:...||.|||:..:...:..::..|..::..:.:|:|||       :|...:|:|:|.:    
Human    68 PGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGH-------EGTTRSSLDDLSIDGQV 125

  Fly   125 --IRLIMKQYKWEK--VSLVGHSMSSIICFVFAAVFPDKVDMI 163
              |...::..|..|  ..|||.||...:..|:||.:|..|..:
Human   126 KRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11309NP_649301.1 alpha/beta hydrolases 69..324 CDD:473884 27/103 (26%)
ABHD6XP_005265391.1 MenH 51..328 CDD:440361 28/108 (26%)

Return to query results.
Submit another query.