DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and CPR5

DIOPT Version :9

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_001238481.1 Gene:CPR5 / 4577352 VectorBaseID:AGAP001668 Length:246 Species:Anopheles gambiae


Alignment Length:90 Identity:25/90 - (27%)
Similarity:38/90 - (42%) Gaps:17/90 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PADAEGNYQYAFE-------TSNGIQAQEAGNVNGISGSSSYISPEGVPISLTYVAD-ENGFQPQ 91
            |.:.:.|.||:|.       |.:....||:.:.:.:.||.|.:.|:|...::.|.|| .|||...
Mosquito    57 PEEYDANPQYSFSYGISDALTGDSKSQQESRSGDVVQGSYSVVDPDGTKRTVEYTADPHNGFNAV 121

  Fly    92 GDHLPTAPPIPEAILRALEYIAAHP 116
            ....|         |.|...:||.|
Mosquito   122 VHREP---------LAAKTIVAAAP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 15/53 (28%)
CPR5XP_001238481.1 Chitin_bind_4 66..118 CDD:278791 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.