DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and CPR136

DIOPT Version :9

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_001237148.2 Gene:CPR136 / 4576733 VectorBaseID:AGAP006840 Length:143 Species:Anopheles gambiae


Alignment Length:138 Identity:28/138 - (20%)
Similarity:49/138 - (35%) Gaps:34/138 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLSLCLLAALMLANVYADNINKDAVITREDVNPADAEGNY----QYAFE-------TSNGIQA 54
            |||: |.|:|.|             |::.....:......:|    :|.||       |.:....
Mosquito     1 MFKI-LALIACL-------------AIVASAQYHGVPEHKDYHDHPKYKFEYGVKDPHTGDHKTQ 51

  Fly    55 QEAGNVNGISGSSSYISPEGVPISLTYVAD-ENGFQPQ-----GDHLPTAP---PIPEAILRALE 110
            .|..:.:.:.|..:....:|....:.|.:| .|||:..     ..|.|:.|   |:...:..|..
Mosquito    52 WEVRDGDVVKGQYTLHEADGTERVVDYKSDGHNGFEADVKKVGHAHHPSHPVHAPVHAPVHHAPT 116

  Fly   111 YIAAHPPQ 118
            :...|.|:
Mosquito   117 HAPVHVPE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 11/57 (19%)
CPR136XP_001237148.2 Chitin_bind_4 34..86 CDD:278791 10/51 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.