powered by:
Protein Alignment Cpr78Cc and Cpr72Ec
DIOPT Version :9
Sequence 1: | NP_649300.1 |
Gene: | Cpr78Cc / 40355 |
FlyBaseID: | FBgn0037069 |
Length: | 119 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648884.1 |
Gene: | Cpr72Ec / 39816 |
FlyBaseID: | FBgn0036619 |
Length: | 429 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 18/72 - (25%) |
Similarity: | 31/72 - (43%) |
Gaps: | 7/72 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 AEGNYQYAFETSNGIQAQEAGNVNGISGSSSYISPEGVPISLTYVAD-ENGFQPQGDHLPTAP-- 99
|...|.|.:...|..:|:.:.......|..||:..:|...::.|.|: ..||:.:..:.|.||
Fly 35 ARAFYSYGYRDENAARAEYSSRDGTSRGFYSYVDADGKLQTVRYEANGVQGFKAEASNQPQAPVD 99
Fly 100 ----PIP 102
|:|
Fly 100 KGKAPLP 106
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.