DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and Cpr65Eb

DIOPT Version :10

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_648076.3 Gene:Cpr65Eb / 38774 FlyBaseID:FBgn0035736 Length:179 Species:Drosophila melanogaster


Alignment Length:125 Identity:67/125 - (53%)
Similarity:80/125 - (64%) Gaps:9/125 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLSLCLLAAL-MLANVYA---DNINKDAVITREDVNPADAE-GNYQYAFETSNGIQAQEAGNV 60
            |.|:::.:|.|: :|..|.|   |:.:..|.| |..||....| |.|.|.|||||||..||.| |
  Fly     1 MSKINVVVLVAMSVLLGVQARPSDSPDAHAEI-RSFVNELKQEDGIYNYQFETSNGIAQQEQG-V 63

  Fly    61 NG--ISGSSSYISPEGVPISLTYVADENGFQPQGDHLPTAPPIPEAILRALEYIAAHPPQ 118
            .|  .||||.|.:|||..|.|||.||||||||||:||||..|||||||::|||...||.:
  Fly    64 GGYYASGSSQYYTPEGQLIQLTYTADENGFQPQGEHLPTPHPIPEAILKSLEYNRNHPEE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:459790 30/47 (64%)
Cpr65EbNP_648076.3 Chitin_bind_4 46..93 CDD:459790 30/47 (64%)

Return to query results.
Submit another query.