DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and Cpr62Bc

DIOPT Version :9

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001261293.1 Gene:Cpr62Bc / 38241 FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster


Alignment Length:164 Identity:39/164 - (23%)
Similarity:56/164 - (34%) Gaps:59/164 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FKLSLCLLAALMLAN-----------------VYADNINKDAVITREDVNPADAEGNYQYAFETS 49
            ||..:| ||.|..|:                 :||.:.:.|..|...      |...|.|.:   
  Fly     4 FKSLIC-LAVLSAASAGVLHGHGAGLYAAAPAIYAGHGHHDEGIDYH------AYPKYHYNY--- 58

  Fly    50 NGIQAQEAGNVNG---------ISGSSSYISPEGVPISLTYVADE-NGFQ-------PQGDHLPT 97
             |:.....|:|..         :.||.|.:.|:|...::.|.||: |||.       |...|  .
  Fly    59 -GVADSHTGDVKSQHEVRDGDVVKGSYSLVEPDGSVRTVEYTADDHNGFNAVVHKTGPTVHH--A 120

  Fly    98 APPI-----PEAILRALEY-------IAAHPPQP 119
            ||.:     |..:..|..|       :||.|..|
  Fly   121 APAVVAHAAPAVVHAAPAYAPAIAHHVAAAPAVP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 14/55 (25%)
Cpr62BcNP_001261293.1 Chitin_bind_4 54..106 CDD:395303 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.