DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and Cpr49Ac

DIOPT Version :9

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster


Alignment Length:98 Identity:30/98 - (30%)
Similarity:54/98 - (55%) Gaps:11/98 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DNINKDAVITREDVNPADAEGNYQYAFETSNGIQAQEAGNVNGISGSSS-----YISPEGVPISL 79
            |:..:..::.:|:|...|   .|.:::.|.|||..:|...::...|:.:     |...:|....:
  Fly   156 DDEGRHKILHKEEVRKQD---KYDHSYLTENGIYGEEQAKLHHTGGTHAKGFYEYTGDDGKLYRV 217

  Fly    80 TYVADENGFQPQGDHLPTAPPIPEAILRALEYI 112
            .|.:::.||.|||||:   .|||:||:|||:|:
  Fly   218 NYASNDGGFMPQGDHI---HPIPDAIVRALKYV 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 10/50 (20%)
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 10/50 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.