DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and Cpr47Ed

DIOPT Version :10

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:102 Identity:31/102 - (30%)
Similarity:50/102 - (49%) Gaps:13/102 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLSLCLLAALMLANVYAD--NINKDAVITREDVNPADAEGNYQYAFETSNGIQAQEAGNVNG- 62
            ||.|.|.|....:|.:..|:  :||....|.: .|....:.|:|.::||:::|...:|.|.|:. 
  Fly     1 MFALLLILTGCQLLWSCPAECTSINVPVPILK-SVTEQLSSGSYLFSFESADGTYREELGIVSSD 64

  Fly    63 ---------ISGSSSYISPEGVPISLTYVADENGFQP 90
                     :||...||:..|..:.:.|.||:|||.|
  Fly    65 SKTSDDDLEVSGIYRYINDWGQEVEVRYTADKNGFLP 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:459790 16/55 (29%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:459790 16/55 (29%)

Return to query results.
Submit another query.