DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and Cpr30B

DIOPT Version :9

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster


Alignment Length:106 Identity:26/106 - (24%)
Similarity:43/106 - (40%) Gaps:14/106 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FKLSLCLLAALMLANVYADNINKDAVITREDVNPADAEGNYQYAFETSNGIQAQ-EAGNVNGISG 65
            :.|.|||.:|:....:.|:          .|..|...|..:......:..|::| |:...:.:.|
  Fly     7 YLLCLCLASAVWAIELQAE----------PDYGPVAYEFQWSVNDPHTGDIKSQKESRKDDKVEG 61

  Fly    66 SSSYISPEGVPISLTYVADE-NGFQPQGDHLPT--APPIPE 103
            ....|..:|....:.|.||: |||:......||  ..|:||
  Fly    62 VYELIDSDGYRRIVQYKADDHNGFEAIVQREPTDIKIPLPE 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 10/47 (21%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 11/51 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.