DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and Pcp

DIOPT Version :9

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:119 Identity:49/119 - (41%)
Similarity:74/119 - (62%) Gaps:8/119 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FKLSLCLLAALMLANVYADNINKDAVITREDVNPADAEGNYQYAFETSNGIQAQEAGNVNGIS-- 64
            |.::|.:| .:...:.|..:.:::....:.|:. .:.:|.|:||:||||||.|.:.| :.|::  
  Fly     7 FIVALAVL-QVQAGSSYIPDSDRNTRTLQNDLQ-VERDGKYRYAYETSNGISASQEG-LGGVAVQ 68

  Fly    65 GSSSYISPEGVPISLTYVADENGFQPQGDHLPTAPPIPEAILRALEYIAAHPPQ 118
            |.|||.||||..||:.|||||.|:.|.|.|:   |.:|:.|||:||||..||.|
  Fly    69 GGSSYTSPEGEVISVNYVADEFGYHPVGAHI---PQVPDYILRSLEYIRTHPYQ 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 27/47 (57%)
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 27/47 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.