DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and Cpr11B

DIOPT Version :9

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:85 Identity:35/85 - (41%)
Similarity:46/85 - (54%) Gaps:9/85 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ITREDVNPADAEGNYQYAFETSNGIQAQEAGNVN--------GISGSSSYISPEGVPISLTYVAD 84
            |.|.|.| :||.|||.:.|:|.|||...|.|...        |:.||.||...:|...::.|.||
  Fly    72 IVRSDYN-SDANGNYNFGFDTGNGIHRDETGEFRGGWPHGSLGVQGSYSYTGDDGKQYTVNYTAD 135

  Fly    85 ENGFQPQGDHLPTAPPIPEA 104
            :|||..:|.|||.:|.:|.|
  Fly   136 KNGFHAEGAHLPVSPSVPAA 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 18/53 (34%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.