DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and Cpr65Av

DIOPT Version :10

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster


Alignment Length:106 Identity:40/106 - (37%)
Similarity:61/106 - (57%) Gaps:15/106 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLCLLAA---LMLANVYADNI--NKDAVITREDVNPADAEGNYQYAFETSNGIQAQEAGNVN--- 61
            |:|:||.   .:|:.:.|..:  ::.|.|.|.|.:....:| |.:.:|||:|:..||...|.   
  Fly     5 SICVLAICAFALLSTIRAAPLDDSQHATILRYDNDNIGTDG-YNFGYETSDGVTRQEQAEVKNAG 68

  Fly    62 ------GISGSSSYISPEGVPISLTYVADENGFQPQGDHLP 96
                  .:.||.|:::|:|...:|.|:||||||||||||||
  Fly    69 TDQEALSVRGSVSWVAPDGQTYTLHYIADENGFQPQGDHLP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:459790 19/54 (35%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:459790 19/54 (35%)

Return to query results.
Submit another query.