DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and Cpr5C

DIOPT Version :10

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_572266.1 Gene:Cpr5C / 31510 FlyBaseID:FBgn0029811 Length:145 Species:Drosophila melanogaster


Alignment Length:85 Identity:18/85 - (21%)
Similarity:33/85 - (38%) Gaps:6/85 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DAEGNYQYAFETSNGIQAQEAGNV-----NGISGSSSYISPEGVPISLTYVADE-NGFQPQGDHL 95
            |....|:||::..:.|.......|     :.:.|..|.:..:|...::.|.||. |||....:..
  Fly    59 DPHPQYKYAYDVQDAISGDSKSQVEERDGDVVRGEYSLVDSDGFKRTVQYTADPINGFNAVVNRE 123

  Fly    96 PTAPPIPEAILRALEYIAAH 115
            |....:.:.:.......||:
  Fly   124 PLVKTVVKTVAPVAPVYAAY 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:459790 12/51 (24%)
Cpr5CNP_572266.1 Chitin_bind_4 64..116 CDD:459790 12/51 (24%)

Return to query results.
Submit another query.