DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and Cpr60D

DIOPT Version :9

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001286853.1 Gene:Cpr60D / 246492 FlyBaseID:FBgn0050163 Length:93 Species:Drosophila melanogaster


Alignment Length:91 Identity:31/91 - (34%)
Similarity:46/91 - (50%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLSLCLLAALMLANVYADNINKDAVITREDVNPADAEGNYQYAFETSNGIQAQEAGNVNGISG 65
            |.|.||.....::||:...:::... ::..|:....|..|.:|:....|||||.:..||||||.|
  Fly     1 MLKYSLIFALFVVLASCSEEDLQAQ-LLKSENRQNLDGAGQFQHEITVSNGIQVKAQGNVNGIQG 64

  Fly    66 SSSYISPEGVPISLTYVADENGFQPQ 91
            .......:|..|.:||.||..||.|:
  Fly    65 EYFLPGEDGKQIRVTYTADATGFHPK 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 19/45 (42%)
Cpr60DNP_001286853.1 Chitin_bind_4 41..87 CDD:278791 19/45 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.