DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and Cpr49Aa

DIOPT Version :10

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:132 Identity:63/132 - (47%)
Similarity:83/132 - (62%) Gaps:20/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLCLLAALMLANVYA-DNINKDA------VITRE-DVNPADAEGNYQYAFETSNGIQAQEAG--- 58
            :|..:|||:|:...| ..:...|      :|.:| :||   .:|:|:|.:||.|||.|:|.|   
  Fly     4 TLLFIAALLLSLAQARPQVRGQAPGEPIPIIRQEQEVN---FDGSYKYLYETGNGINAEEEGYLK 65

  Fly    59 -----NVNGIS-GSSSYISPEGVPISLTYVADENGFQPQGDHLPTAPPIPEAILRALEYIAAHPP 117
                 |...:: ||.||.||||:||.:||:|||||||||||||||.||||.||.:||.|:|..||
  Fly    66 NPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAYLATAPP 130

  Fly   118 QP 119
            .|
  Fly   131 PP 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:459790 27/54 (50%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 27/54 (50%)

Return to query results.
Submit another query.