DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and CPR81

DIOPT Version :9

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_318999.3 Gene:CPR81 / 1279298 VectorBaseID:AGAP009879 Length:131 Species:Anopheles gambiae


Alignment Length:121 Identity:41/121 - (33%)
Similarity:63/121 - (52%) Gaps:26/121 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLSLCLLAALMLA---------------NVYADNINKDAVITREDVNPADAEGNYQYAFETSNGI 52
            |..:.|:|||:.|               .||. .....|||..:...| :.:|:|.|::||||||
Mosquito     2 KFVVLLVAALVAATSAQIRPLPIPLRNPGVYG-GPEASAVILNQVYEP-NPDGSYVYSYETSNGI 64

  Fly    53 QAQEAGNVNG---------ISGSSSYISPEGVPISLTYVADENGFQPQGDHLPTAP 99
            :|.:.|.:..         :.||.||..|:||..::.|:|||||::.:|.|:|:||
Mosquito    65 RADQRGFLKNPGTPGEAQVMQGSYSYTGPDGVVYTINYIADENGYRAEGAHIPSAP 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 22/54 (41%)
CPR81XP_318999.3 Chitin_bind_4 54..109 CDD:278791 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.