DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and CPR78

DIOPT Version :9

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_318996.4 Gene:CPR78 / 1279295 VectorBaseID:AGAP009876 Length:137 Species:Anopheles gambiae


Alignment Length:134 Identity:56/134 - (41%)
Similarity:76/134 - (56%) Gaps:25/134 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLSLCLLAALMLA---------NVYADNINKDAVITRE-DVNPADAEGNYQYAFETSNGIQAQEA 57
            |:.:|....|:||         ....:.|   .:|.:| :|||   :|:|.:::||.|||.|:|.
Mosquito     2 KVIICACVVLLLAFGGVECAPQGPATEPI---PIIRQEQEVNP---DGSYSWSYETGNGIVAEEQ 60

  Fly    58 GNVNG---------ISGSSSYISPEGVPISLTYVADENGFQPQGDHLPTAPPIPEAILRALEYIA 113
            |.:..         ..|..||.:|:|..|.:.|:||||||||.||||||.||||.||.|||||:|
Mosquito    61 GFLKNPGTEQEAQVAQGEYSYTAPDGQLIRVQYIADENGFQPLGDHLPTPPPIPPAIQRALEYLA 125

  Fly   114 AHPP 117
            :.||
Mosquito   126 SLPP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 20/54 (37%)
CPR78XP_318996.4 Chitin_bind_4 45..100 CDD:278791 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.