DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and CPR77

DIOPT Version :9

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_318995.4 Gene:CPR77 / 1279294 VectorBaseID:AGAP009875 Length:126 Species:Anopheles gambiae


Alignment Length:123 Identity:66/123 - (53%)
Similarity:80/123 - (65%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLSLCLLAALMLANVYADNINKDAVITRED--VNPADAEGNYQYAFETSNGIQAQEAGNVNGI 63
            |.||:..|:.|| :|.|.||   |||.:.|:|  |||   :|.||||:||||||.|:|.|.:..:
Mosquito     1 MNKLASVLVIAL-IATVAAD---KDATVLRQDAEVNP---DGTYQYAYETSNGIVAEEQGTLKNL 58

  Fly    64 --------SGSSSYISPEGVPISLTYVADENGFQPQGDHLPTAPPIPEAILRALEYIA 113
                    .|..||..|||..:|:.|:|||||||||||||||.|||||||.|||..:|
Mosquito    59 GEEQAQVAQGQYSYTDPEGNRVSVQYIADENGFQPQGDHLPTPPPIPEAIERALRLLA 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 25/53 (47%)
CPR77XP_318995.4 Chitin_bind_4 37..91 CDD:278791 25/53 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10380
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.