DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cc and CPR12

DIOPT Version :9

Sequence 1:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster
Sequence 2:XP_315456.3 Gene:CPR12 / 1276146 VectorBaseID:AGAP005453 Length:146 Species:Anopheles gambiae


Alignment Length:130 Identity:58/130 - (44%)
Similarity:78/130 - (60%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKLSLCLLAALMLANV--------YADNINKDA---VITREDVNPADAEGNYQYAFETSNGIQA 54
            ||:  ....|||::|.|        |:...|.||   ::..|:|...|  |:|.:::||||||.|
Mosquito     1 MFR--FVFAAALLVATVAAGPLDRAYSHQQNPDAHAQIVAYENVLKDD--GHYNWSYETSNGIAA 61

  Fly    55 QEAG-NVNGISGSSSYISPEGVPISLTYVADENGFQPQGDHLPTAPPIPEAILRALEYIAAHPPQ 118
            .|.| ..:..:|:.||..|:||...:.|||||||||||||||||.||.||.:.:.||.|.|:||:
Mosquito    62 HEEGLGAHNANGAFSYTGPDGVLYRVVYVADENGFQPQGDHLPTPPPTPEHVFKTLEQIRANPPK 126

  Fly   119  118
            Mosquito   127  126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 22/46 (48%)
CPR12XP_315456.3 Chitin_bind_4 49..96 CDD:278791 22/46 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I19156
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D125453at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.