DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg78E and Lcp65Ag3

DIOPT Version :9

Sequence 1:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:104 Identity:28/104 - (26%)
Similarity:48/104 - (46%) Gaps:12/104 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KYLFC-LALIGCACADNINKDAQIRSFQNDATDAEGNYQYAYETSNGIQIQEAGNAN-------- 58
            |:|.. :||...|.|....::..|...::|.  ...:::|.:|||:|...|..|..|        
  Fly     2 KFLIVFVALFAVALAAPAAEEPTIVRSESDV--GPESFKYDWETSDGQAAQAVGQLNDIGTENEA 64

  Fly    59 -GARGAVAYVSPEGEHISLTYTADEEGYHPVGDHLPTPP 96
             ...|:..:::.:|:...:.|.||:.|:.|.|.|||..|
  Fly    65 ISVSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLPVAP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 13/54 (24%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:278791 13/54 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.