DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg78E and CG8927

DIOPT Version :9

Sequence 1:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:101 Identity:25/101 - (24%)
Similarity:36/101 - (35%) Gaps:33/101 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NKDAQIR-SFQND---------ATD--AEGNY----------QYAYET---------SNGIQIQE 53
            |:|..|. .::||         .||  .:|.|          :|.|||         :|..::||
  Fly   269 NEDGSITWGYENDDGSFKEELIGTDCITKGTYGYVDPDGNKREYHYETGIKCDPNNRNNEEELQE 333

  Fly    54 AGNANGARGAVAYVSPEGEHISLTYTADEEGYHPVG 89
            .|..|......  |.|.|..|.:|....::...|.|
  Fly   334 NGFVNYEENRA--VLPNGLEIDMTQLGKKKSKRPNG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 15/64 (23%)
CG8927NP_650527.2 Chitin_bind_4 276..336 CDD:278791 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.