DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg78E and Cpr78Cc

DIOPT Version :9

Sequence 1:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster


Alignment Length:119 Identity:72/119 - (60%)
Similarity:83/119 - (69%) Gaps:3/119 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKYLFCL---ALIGCACADNINKDAQIRSFQNDATDAEGNYQYAYETSNGIQIQEAGNANGARG 62
            |:|...||   .::....||||||||.|.....:..|||||||||:|||||||.|||||.||..|
  Fly     1 MFKLSLCLLAALMLANVYADNINKDAVITREDVNPADAEGNYQYAFETSNGIQAQEAGNVNGISG 65

  Fly    63 AVAYVSPEGEHISLTYTADEEGYHPVGDHLPTPPPVPAYVLRALEYIRTHPPAP 116
            :.:|:||||..|||||.|||.|:.|.||||||.||:|..:|||||||..|||.|
  Fly    66 SSSYISPEGVPISLTYVADENGFQPQGDHLPTAPPIPEAILRALEYIAAHPPQP 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 32/45 (71%)
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 32/45 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470209
Domainoid 1 1.000 47 1.000 Domainoid score I19156
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D125453at33392
OrthoFinder 1 1.000 - - FOG0014331
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.