DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg78E and Cpr67Fb

DIOPT Version :9

Sequence 1:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:111 Identity:53/111 - (47%)
Similarity:69/111 - (62%) Gaps:8/111 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFCLALIGCACADNINKDAQIRSFQNDATDAEGNYQYAYETSNGIQIQEAGNANG--ARGAVAYV 67
            ||.:|.|  ..||  ...|:...::|: ...:|:|.:.|.|||||..||:| ..|  |.|:|:|.
  Fly    10 LFLVAAI--RAAD--ESQAETTKYRNE-IKPDGSYSWEYGTSNGIDAQESG-VGGVQAAGSVSYA 68

  Fly    68 SPEGEHISLTYTADEEGYHPVGDHLPTPPPVPAYVLRALEYIRTHP 113
            :|:|..|.|.|||||.||.|.|.|||||||:|.|:|:||.||..||
  Fly    69 APDGTPIQLEYTADENGYRPTGAHLPTPPPIPDYILKALAYIEAHP 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 24/47 (51%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:278791 24/47 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470211
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26179
OrthoDB 1 1.010 - - D125453at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.