DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg78E and Cpr67Fa2

DIOPT Version :9

Sequence 1:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_648419.1 Gene:Cpr67Fa2 / 39224 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster


Alignment Length:118 Identity:60/118 - (50%)
Similarity:76/118 - (64%) Gaps:6/118 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKY-LFCLALIGCAC-ADNINKD--AQIRSFQNDATDAEGNYQYAYETSNGIQIQEAG-NANGA 60
            |::| |...|::.||. |...|::  |.|....:| ...||||.|.|||||||..||:| ..|.|
  Fly     1 MFRYMLVASAVLACAYGAATYNQEAGAYITKIGSD-IQPEGNYNYQYETSNGIAAQESGIGGNHA 64

  Fly    61 RGAVAYVSPEGEHISLTYTADEEGYHPVGDHLPTPPPVPAYVLRALEYIRTHP 113
            .|..::.|||||.:.::|.|||.||.|.|..||||||:||.:||:||||||||
  Fly    65 NGGFSWYSPEGELVQISYVADENGYQPQGALLPTPPPIPAAILRSLEYIRTHP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 24/46 (52%)
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:278791 24/46 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470205
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D125453at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.