DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg78E and Cpr65Az

DIOPT Version :9

Sequence 1:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster


Alignment Length:84 Identity:41/84 - (48%)
Similarity:53/84 - (63%) Gaps:10/84 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DAEGNYQYAYETSNGIQIQEAG----------NANGARGAVAYVSPEGEHISLTYTADEEGYHPV 88
            :.:|:|.|.|||.|||:.:|.|          .|..|.|:.:|.||||:.|||||.|||.|:.|.
  Fly   124 NTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADENGFQPQ 188

  Fly    89 GDHLPTPPPVPAYVLRALE 107
            |||||||||:|..:..||:
  Fly   189 GDHLPTPPPIPIEIQEALD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 26/55 (47%)
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439328
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.