DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg78E and Cpr47Ee

DIOPT Version :9

Sequence 1:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_610659.1 Gene:Cpr47Ee / 36193 FlyBaseID:FBgn0033602 Length:369 Species:Drosophila melanogaster


Alignment Length:139 Identity:34/139 - (24%)
Similarity:56/139 - (40%) Gaps:43/139 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IRSFQNDATDAEGNYQYAYETSNGIQIQEAG-----------NANGARGAVAYVSPEGEHISLTY 78
            |.::||: .:.:|::.|.|.:::|...|..|           .|...:|:.:|.||||..|::.|
  Fly   107 ITAYQNE-LNLDGSFSYGYSSADGTTAQAQGYVKNLGYGEGVEAQVIQGSYSYTSPEGTPITVRY 170

  Fly    79 TADEEGYHPVGDHLPT------------------------------PPPVPAYVLRALEYIRTHP 113
            .|||.|:...|..:|:                              |||:|....|. :.....|
  Fly   171 IADENGFRAEGTGIPSSPQYFAGAQPYQQGLLNPNLNPYQTPFRQLPPPLPNAPFRP-QLPGQQP 234

  Fly   114 PAPAQKEQQ 122
            ..|.|::||
  Fly   235 LTPLQQQQQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 17/56 (30%)
Cpr47EeNP_610659.1 Chitin_bind_4 120..177 CDD:278791 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.