DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg78E and Cpr49Aa

DIOPT Version :9

Sequence 1:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:100 Identity:46/100 - (46%)
Similarity:62/100 - (62%) Gaps:9/100 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QNDATDAEGNYQYAYETSNGIQIQEAG--------NANG-ARGAVAYVSPEGEHISLTYTADEEG 84
            |....:.:|:|:|.|||.|||..:|.|        ||.. |:|:.:|.||||..|.:||.|||.|
  Fly    36 QEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTDNAGQVAQGSFSYTSPEGIPIRITYLADENG 100

  Fly    85 YHPVGDHLPTPPPVPAYVLRALEYIRTHPPAPAQK 119
            :.|.|||||||||:|..:.:||.|:.|.||.|.::
  Fly   101 FQPQGDHLPTPPPIPPAIQKALAYLATAPPPPQEQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 25/54 (46%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439314
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.