DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Edg78E and LOC1272758

DIOPT Version :10

Sequence 1:NP_524198.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster
Sequence 2:XP_311664.4 Gene:LOC1272758 / 1272758 VectorBaseID:AGAMI1_001020 Length:128 Species:Anopheles gambiae


Alignment Length:86 Identity:27/86 - (31%)
Similarity:37/86 - (43%) Gaps:18/86 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YQYAYE-----TSNGIQIQEAGNANGARGAVAYVSPEGEHISLTYTADE-EGYHPVGDHLPTPP- 96
            |.|||.     |.:....||..:.:..||:.:.|.|:|...::.||||. .|::.|....|..| 
Mosquito    42 YTYAYNVQDALTGDSKSQQETRDGDIVRGSYSLVEPDGTLRTVFYTADPVNGFNAVVQRGPLVPK 106

  Fly    97 ---PV--------PAYVLRAL 106
               ||        ||.|.|.|
Mosquito   107 AVVPVAAGPAILAPAPVARVL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Edg78ENP_524198.1 Chitin_bind_4 39..85 CDD:459790 16/51 (31%)
LOC1272758XP_311664.4 Chitin_bind_4 42..94 CDD:459790 16/51 (31%)

Return to query results.
Submit another query.