DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cb and LOC4578106

DIOPT Version :10

Sequence 1:NP_649299.2 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_001238070.3 Gene:LOC4578106 / 4578106 VectorBaseID:AGAMI1_007234 Length:334 Species:Anopheles gambiae


Alignment Length:116 Identity:27/116 - (23%)
Similarity:42/116 - (36%) Gaps:25/116 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LLYSCKSHRSNLRF-AFPPSSVS-----TATETGEENS--------KSTGNYAFLEESFRTGRFL 84
            ||:.|....::..| ...|..||     .|.:.|..|.        ||.|...:.::..:. ..|
Mosquito   338 LLFQCNQMSADYLFQQDKPYDVSFDTGDKAIQCGRHNDVFKLWLMWKSKGMEGYRQQINKL-MDL 401

  Fly    85 SNDELEKLKTLEGFAYFQELESGSMWVRVMRHEEMDSTVHLLAESFGESML 135
            :|....::|..|||....|..|   :.|:..|       ..|..:|.:|.|
Mosquito   402 ANYFTRRIKETEGFELIIENVS---FARIPEH-------LFLVRAFKDSKL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CbNP_649299.2 Chitin_bind_4 55..101 CDD:459790 13/58 (22%)
LOC4578106XP_001238070.3 Chitin_bind_4 249..304 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.