DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cb and Ccp84Ab

DIOPT Version :10

Sequence 1:NP_649299.2 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:61 Identity:15/61 - (24%)
Similarity:24/61 - (39%) Gaps:10/61 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 FKTSNGIDVQAAGSPLETI---------GIYSYTSPEGVPIETRYIADEL-GFHVVGRHLP 109
            ::.|.|:|.:..|.....:         |.||....:|.....:|.||.: ||:.|....|
  Fly    62 YRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNREP 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CbNP_649299.2 Chitin_bind_4 55..101 CDD:459790 11/51 (22%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:459790 11/51 (22%)

Return to query results.
Submit another query.