DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cb and Cpr67Fa2

DIOPT Version :9

Sequence 1:NP_001262144.1 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_648419.1 Gene:Cpr67Fa2 / 39224 FlyBaseID:FBgn0036109 Length:134 Species:Drosophila melanogaster


Alignment Length:96 Identity:44/96 - (45%)
Similarity:55/96 - (57%) Gaps:2/96 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ERDARITDFRVSPTDDEGVFKYAFKTSNGIDVQAAG-SPLETIGIYSYTSPEGVPIETRYIADEL 99
            |..|.||... |....||.:.|.::|||||..|.:| ......|.:|:.||||..::..|:|||.
  Fly    24 EAGAYITKIG-SDIQPEGNYNYQYETSNGIAAQESGIGGNHANGGFSWYSPEGELVQISYVADEN 87

  Fly   100 GFHVVGRHLPQPPPTPDYILRSLEYIRTHTE 130
            |:...|..||.|||.|..|||||||||||.:
  Fly    88 GYQPQGALLPTPPPIPAAILRSLEYIRTHPQ 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CbNP_001262144.1 Chitin_bind_4 55..101 CDD:278791 18/46 (39%)
Cpr67Fa2NP_648419.1 Chitin_bind_4 42..89 CDD:278791 18/46 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470146
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D125453at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.