DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cb and Cpr49Ah

DIOPT Version :9

Sequence 1:NP_001262144.1 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:85 Identity:32/85 - (37%)
Similarity:44/85 - (51%) Gaps:10/85 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DEGVFKYAFKTSNGIDVQAAG-------SP---LETIGIYSYTSPEGVPIETRYIADELGFHVVG 105
            |:|.:|..::|.|.|..:..|       :|   |...|.|||.||||..:..:|.|||.||...|
  Fly    62 DDGSYKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADENGFRATG 126

  Fly   106 RHLPQPPPTPDYILRSLEYI 125
            .|:|.||..|:.|.:.|:.|
  Fly   127 DHIPTPPAIPEEIQKGLDQI 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CbNP_001262144.1 Chitin_bind_4 55..101 CDD:278791 19/55 (35%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:395303 19/55 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.