DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Cb and Cpr49Af

DIOPT Version :10

Sequence 1:NP_649299.2 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:82 Identity:33/82 - (40%)
Similarity:41/82 - (50%) Gaps:9/82 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SPTDDEGVFKYAFKTSNGIDVQAAGSPLETIGIYSYTSPEGVPIETRYIADELGFHVVGRHLPQP 111
            |....:||.|......||..|.         |.||:.:.:|......|.|||.|:..||.|||.|
  Fly    45 SKATQDGVLKSVNADHNGESVN---------GKYSFVADDGKTYVVSYTADENGYLAVGDHLPTP 100

  Fly   112 PPTPDYILRSLEYIRTH 128
            ||||..:|::|||||.|
  Fly   101 PPTPVSVLKALEYIRLH 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CbNP_649299.2 Chitin_bind_4 55..101 CDD:459790 12/45 (27%)
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 15/53 (28%)

Return to query results.
Submit another query.