DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Ca and CG8927

DIOPT Version :10

Sequence 1:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_650527.2 Gene:CG8927 / 41964 FlyBaseID:FBgn0038405 Length:371 Species:Drosophila melanogaster


Alignment Length:64 Identity:14/64 - (21%)
Similarity:25/64 - (39%) Gaps:8/64 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DPFGH-YSFEFQT-----TNGITTKGAGNENGAVGVVQ--FVSPEGIPVTFSYVADANGYQPTG 96
            ||.|: ..:.::|     .|....:....|||.|...:  .|.|.|:.:..:.:......:|.|
  Fly   304 DPDGNKREYHYETGIKCDPNNRNNEEELQENGFVNYEENRAVLPNGLEIDMTQLGKKKSKRPNG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 9/52 (17%)
CG8927NP_650527.2 Chitin_bind_4 277..336 CDD:459790 7/31 (23%)

Return to query results.
Submit another query.