DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Ca and Cpr78Cc

DIOPT Version :9

Sequence 1:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster


Alignment Length:83 Identity:42/83 - (50%)
Similarity:57/83 - (68%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PPDPFGHYSFEFQTTNGITTKGAGNENGAVGVVQFVSPEGIPVTFSYVADANGYQPTGDHIPA-- 101
            |.|..|:|.:.|:|:|||..:.|||.||..|...::||||:|::.:||||.||:||.|||:|.  
  Fly    35 PADAEGNYQYAFETSNGIQAQEAGNVNGISGSSSYISPEGVPISLTYVADENGFQPQGDHLPTAP 99

  Fly   102 -IPLHVIRQLEYIRTHPP 118
             ||..::|.||||..|||
  Fly   100 PIPEAILRALEYIAAHPP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:278791 22/45 (49%)
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:278791 22/45 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 1 1.000 - - FOG0014331
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.