DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Ca and Edg78E

DIOPT Version :9

Sequence 1:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_001287140.1 Gene:Edg78E / 40354 FlyBaseID:FBgn0000551 Length:122 Species:Drosophila melanogaster


Alignment Length:114 Identity:49/114 - (42%)
Similarity:69/114 - (60%) Gaps:4/114 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VFLVLVLVQLIHCTRFTAPSLDRTI-YYRNTPPDPFGHYSFEFQTTNGITTKGAGNENGAVGVVQ 72
            ::..|..:.||.|......:.|..| .::|...|..|:|.:.::|:|||..:.|||.|||.|.|.
  Fly     1 MYKYLFCLALIGCACADNINKDAQIRSFQNDATDAEGNYQYAYETSNGIQIQEAGNANGARGAVA 65

  Fly    73 FVSPEGIPVTFSYVADANGYQPTGDHIPA---IPLHVIRQLEYIRTHPP 118
            :|||||..::.:|.||..||.|.|||:|.   :|.:|:|.|||||||||
  Fly    66 YVSPEGEHISLTYTADEEGYHPVGDHLPTPPPVPAYVLRALEYIRTHPP 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:278791 21/45 (47%)
Edg78ENP_001287140.1 Chitin_bind_4 39..85 CDD:395303 21/45 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 1 1.000 - - FOG0014331
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.