DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Ca and Cpr49Ad

DIOPT Version :10

Sequence 1:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:106 Identity:28/106 - (26%)
Similarity:41/106 - (38%) Gaps:42/106 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RTIYYRN--------------TPPDPF-------------------GHYSFEFQTTNGITTKGAG 62
            |.:||||              ...:|:                   |.||:.::|.|||..:..|
  Fly    35 RDLYYRNRDLYNLRRFYDGFYKKYNPYIAAAQARIVEQNNDVNYGAGSYSYNYETENGIHGEERG 99

  Fly    63 ---------NENGAVGVVQFVSPEGIPVTFSYVADANGYQP 94
                     .|....|...|::|||:.|...|:|||||::|
  Fly   100 VPVNIGNQQQEEQVEGAYSFITPEGLRVGVKYLADANGFRP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 19/54 (35%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:459790 19/54 (35%)

Return to query results.
Submit another query.