DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Ca and Cpr49Ad

DIOPT Version :9

Sequence 1:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:106 Identity:28/106 - (26%)
Similarity:41/106 - (38%) Gaps:42/106 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RTIYYRN--------------TPPDPF-------------------GHYSFEFQTTNGITTKGAG 62
            |.:||||              ...:|:                   |.||:.::|.|||..:..|
  Fly    35 RDLYYRNRDLYNLRRFYDGFYKKYNPYIAAAQARIVEQNNDVNYGAGSYSYNYETENGIHGEERG 99

  Fly    63 ---------NENGAVGVVQFVSPEGIPVTFSYVADANGYQP 94
                     .|....|...|::|||:.|...|:|||||::|
  Fly   100 VPVNIGNQQQEEQVEGAYSFITPEGLRVGVKYLADANGFRP 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:278791 19/54 (35%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.