DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr78Ca and Cpr47Ef

DIOPT Version :10

Sequence 1:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster


Alignment Length:102 Identity:32/102 - (31%)
Similarity:44/102 - (43%) Gaps:33/102 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PPDPF----------GHYSFEFQTTNGI------TTKGAGNEN---GAVGVVQFVSPEGIPVTFS 84
            ||.|.          |:|.|.::|.|||      |.|..|:||   ..:|...:.:|||..|...
  Fly   132 PPIPILSFVNENDGDGNYRFSYETGNGIKAQEEGTVKNKGSENEIPSVMGSYSYTNPEGELVEIM 196

  Fly    85 YVADANGYQPTGDHIPAIPLHVIRQLEYIRTHPPVDE 121
            |.||.||:.|:|:.:|              |.||:.|
  Fly   197 YTADENGFVPSGNALP--------------TPPPIPE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:459790 20/54 (37%)
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:459790 20/54 (37%)

Return to query results.
Submit another query.